NATsDB: Natural Antisense Transcripts DataBase
Browse Search Help Download
AK055408 SA cluster:8872  ?
General information
UniGene ClusterHs.585624
DescriptionHomo sapiens cDNA FLJ30846 fis, clone FEBRA2002783
Local annotation
Conceptual translation>NP_777588:hypothetical protein LOC221143 [Homo sapiens](Evalue:3e-58 Identity:0.869 Coverage:0.311/1)
MSDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENW------------
----------------\IACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYD
YNNPLDLPERIAAHSFDIVIADPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAE
LLGVKMCTFVPRHTRNLANEFRCYVNYDSGLDCGI
>NP_080802:hypothetical protein LOC68043 [Mus musculus](Evalue:1.1e-51 Identity:0.71 Coverage:0.321/0.987)
RGWL*TTCEMSDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENW---
-------------------------\IACVSAPSVYQKLRELCRENFSIYIFEYDKRFAM
YGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPYLSEECLRKTSETVKYLTRGKILLCTG
AIMEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGLDC
>XP_214202:PREDICTED: similar to RIKEN cDNA 2510005D08 [Rattus norvegicus](Evalue:1e-49 Identity:0.712 Coverage:0.318/0.978)
WL*TTCEMSDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENW-----
-----------------------\IACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYG
EEFIFYDYNNPLDLPERIAAHSFDIVIADPPYLSEECLRKTSETVKYLTRGKILLCTGAI
MEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGLDC
Possible ORF>ORF_ Region:[37-213]
TTCEMSDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWNRMCECP
>ORF_ Region:[207-377]
VPLVFTRNSESCAEKTFRYTSLNMTKDLPCMERSLFSMITIIHWTYPKELLHIVLTS
>ORF_ Region:[373-558]
HRNSRSSLSFGGMSQKNIGNRQVPDAGQDSAVHRCHHGRTGSRTPWSEDVHVCSKTHPEL
GK
>ORF_ Region:[182-607]
KRIGIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAA
HSFDIVIADPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRH
TRNLANEFRCYVNYDSGLDCGI
>ORF_ Region:[586-741]
FWAGLWDLITDGDITQEGTLSHSSFCIFVVDLKVIISSPPPKLELSLAWFSK
>ORF_ Region:[624-809]
HNTGRNPVTFLFLYFRSRFKSYNLFPSPQTGAVPGLVFKIKCAIFIIVSLGRASLELSLL
PT
>ORF_ Region:[692-841]
SLPLPPNWSCPWPGFQNKVCDLHYCFLREGVPRAQSSANLNPWNSSWKKP
>ORF_ Region:[1535-1732]
RGPLCPHIQPDPKALTTKPIPAWILLTTGKDVTFHFLSHHLLTTNWPQWLSKGGKNCASL
RLFMYS
>ORF_ Region:[1588-2037]
ANTCLDSSDNWQRCHVPLLISPPLNHKLAPVAFKRGKKLCEFETVYVFMTKTKSEIFGTL
SWPWGMRAACASLWSTWRPVKTFSGRKSGSDETCPFHQSAIGDRLNSETQARVYQLQNLS
KDSNYALKNSTRRSKKRCLYVKKCNRVALI
Cross Reference
GeneLOC221143 hypothetical protein LOC221143
Homologene
5952 Gene conserved in EukaryotaNM_001027523 Caenorhabditis elegans M142.8 (M142.8) mRNA, complete cds
NM_135149 Drosophila melanogaster CG9154-RA (CG9154), mRNA
AJ719998 Gallus gallus mRNA for hypothetical protein, clone 9d5
NM_001006277 Gallus gallus similar to RIKEN cDNA 2510005D08 (LOC418951), mRNA
BC018091 Homo sapiens hypothetical protein LOC221143, mRNA (cDNA clone MGC:27120 IMAGE:4793121), complete cds
CR595343 full-length cDNA clone CS0DJ011YM05 of T cells (Jurkat cell line) Cot 10-normalized of Homo sapiens (human)
NM_174928 Homo sapiens hypothetical protein LOC221143 (LOC221143), mRNA
AK005312 Mus musculus adult male cerebellum cDNA, RIKEN full-length enriched library, clone:1500031E22 product:hypothetical N-6 Adenine-specific DNA methylase containing protein, full insert sequence
AK010911 Mus musculus 13 days embryo liver cDNA, RIKEN full-length enriched library, clone:2510005D08 product:hypothetical 2510005D08RIK ERP6-TFG2 CG9154 M142.5
AK012083 Mus musculus 10 days embryo whole body cDNA, RIKEN full-length enriched library, clone:2610509M16 product:hypothetical 2510005D08RIK ERP6-TFG2 CG9154 M142.5
BC051925 Mus musculus RIKEN cDNA 2510005D08 gene, mRNA (cDNA clone MGC:62166 IMAGE:5691329), complete cds
NM_026526 Mus musculus RIKEN cDNA 2510005D08 gene (2510005D08Rik), mRNA
© Center for Bioinformatics, Peking University