NATsDB: Natural Antisense Transcripts DataBase
Browse Search Help Download
BC008632 SA cluster:30597  ?
General information
UniGene ClusterHs.31917
DescriptionHomo sapiens cDNA clone IMAGE:3464195
Local annotation
Conceptual translation>XP_499048:PREDICTED: hypothetical protein XP_499048 [Homo sapiens](Evalue:4.2e-77 Identity:1 Coverage:0.305/1)
MELSAAAGRRRQAPWREFTGRHRTERSQERGSTPRKERSMGSRQPRKREREPRDCTPTCT
NAASVSRSGARRAPGCAGRCITMKNCARAWRELSERACCFQAVPPSNMKQSWLIFLDTTL
CSAWLLASSCPRLYAPLISFHCMCFNTVLLFPRLFGPTLSAKIQFNTDLSLRAIAWKCTK
DTTTYC
Possible ORF>ORF_ Region:[107-295]
VRSCCCWELELRWTGLHGRPRRWVQLSPRPPDGKEGRRNPTHSPFARRSARTPECPKPLE
SAC
>ORF_ Region:[299-451]
AERASVVDRSRTWPAGFLGNLLCAVLHGTLDPLCSRRLAFFFLFLSLTVSF
>ORF_ Region:[136-459]
AEMDWSSWAPKALGAAFPETPRWKGGKEEPHTLAFCEKIGAHPRVPQAFGICLLSGARER
GGQVPNLASGLSWQLALRSSPWNPGPTVLPAPCLFFSFSFSHCLFLNL
>ORF_ Region:[141-470]
DGLVFMGAQGAGCSFPRDPQMERREGGTPHTRLLREDRRAPQSAPSLWNLPAERSARAWW
TGPELGQRAFLATCFAQFSMEPWTHCAPGALPFFFFFFLSLSLFKFMNSK
>ORF_ Region:[474-671]
SGKQICASAYFGGPFKNGTVGCGWKAQAGALERIHREAQDRTLPGTRKHPQKGALYGLQA
AEETRT
>ORF_ Region:[521-715]
KWNCRLRLEGAGRRPGENSQGGTGQNAPRNEEAPPERSALWAPGSRGNANVSPVTALPRA
PTLPV
>ORF_ Region:[684-839]
LHSHVHQRCQCEQKRSPQSARLRREMHHDEKLRQSMAGTFREGVLFPGGSTF
>ORF_ Region:[463-1080]
TRNEAESRYARQHTLADLLKMELSAAAGRRRQAPWREFTGRHRTERSQERGSTPRKERSM
GSRQPRKREREPRDCTPTCTNAASVSRSGARRAPGCAGRCITMKNCARAWRELSERACCF
QAVPPSNMKQSWLIFLDTTLCSAWLLASSCPRLYAPLISFHCMCFNTVLLFPRLFGPTLS
AKIQFNTDLSLRAIAWKCTKDTTTYC
>ORF_ Region:[1192-1503]
RLSHCHGVRFTHCPHHTDVGLLRAECPMTSSAAQELGVGGNWRNQSDQLQRTLPLLELGC
AGFSTEVLRQRQKQGLWEAPVSSQKGLESGSLRLQIQSCRLGVV
>ORF_ Region:[1332-1517]
SAAKNASIAGAWLCGILHGGLKAETKTRTLGGSCEQPKGFRVRQPQVTNPVLQARSCVSL
KK
Cross Reference
GeneC6orf176 chromosome 6 open reading frame 176
© Center for Bioinformatics, Peking University