NATsDB: Natural Antisense Transcripts DataBase
Browse Search Help Download
BC036212 SA cluster:1754  ?
General information
UniGene ClusterHs.323484
DescriptionHomo sapiens cDNA clone IMAGE:5266739
Local annotation
Conceptual translation>XP_371797:PREDICTED: hypothetical protein XP_371797 [Homo sapiens](Evalue:1.2e-11 Identity:0.494 Coverage:0.086/0.989)
LTARFCAFVL*VRETTNPPGGTNNCDAPSLRAVTFTAGVCGFIP\E*VRPRTHQKEETL-
DPSEQLKEQTPDTPSLRTVTLTGSLRGFIL
>XP_496183:PREDICTED: hypothetical protein XP_496183 [Homo sapiens](Evalue:2.4e-09 Identity:0.542 Coverage:0.08/0.761)
PSLRAVTFTAGVCGFIPGVSET/YEPTRRKKLW/TPSEQLKEQTPDTPSLRTVTLTGSLR
G-----FILEDSETKNPPEGMNSAH
>XP_290609:PREDICTED: hypothetical protein XP_290609 [Homo sapiens](Evalue:1.2e-05 Identity:0.581 Coverage:0.083/0.935)
NNCDAPSLRAVTFTAGVCGFIP\E*VRPRTHQKEETLDPSEQLKEQTPD-----------
TPSLRTVTLTGSLRGFILEDSETKNPP
Possible ORF>ORF_ Region:[153-302]
VRETTNPPGGTNNCDAPSLRAVTFTAGVCGFIPGVSETTNPPEGRNSGPI
>ORF_ Region:[259-474]
VRPRTHQKEETLDPSEQLKEQTPDTPSLRTVTLTGSLRGFILEDSETKNPPEGMNSAHSN
STKLNQEVPLPC
>ORF_ Region:[387-593]
RQRDQEPTRRNEFRTQQQHKVKPGSPSALLGIQVCLPVEVSHFITVDLSLNKHCHLMHES
STVTYVKRS
>ORF_ Region:[618-809]
SVGAYCSIPVAMRERGTSQEHLAPVASWLYKRGTNICSAPDEGLRKFTVMAEGEGEPACH
MNLR
>ORF_ Region:[873-1031]
PLAIDQREAFTTEGLSSLYWVFNFLEIKRKKDKKWYAEWIKGQGPNFNYHHRN
>ORF_ Region:[808-1125]
DETIEKEPRSYIHSSELLESPDLWPSIKGKRSLLKVCLHCTGYSTSLKLKGRRIKSGMLN
GLKDKDQTSIIITEINICGLINEQIFTRSIKRVFHIALTPRKKGPI
>ORF_ Region:[1056-1259]
TNLYQVNKKGISHRTDSSEKRAHLGYNGISHLLCQNDARDPEKGMKASVLCSKVGQRQDK
LEVIFNSM
>ORF_ Region:[1288-1455]
TIKFFQQVNWGEGYNMSDISTIAQRRIIIRFFKRNCSFEDNQKRVETSEIKCILLG
>ORF_ Region:[1884-2045]
SCTSVGTGDSCTCVGTYAWETSVVSVQFCCESKITLKYNVYLKRRGYIKTKATL
>ORF_ Region:[2036-2215]
GYTVSLPLTRSYAAGSFGFSTCELHPQQEHSKGICERKPKLSVLCNLNTYFTIKSLTTKL
>ORF_ Region:[2542-2697]
LGEGHKDRADVQTEEKNQDRQWCCRNLRSVTLKWVSGEQSQISQRCPGRYIH
>ORF_ Region:[2648-2821]
VVSRVKSHRDVQEDISTEFVDMEVISGCCQSTFCSILCHISNFSRSFSHKSKYFDRYY
>ORF_ Region:[2655-2915]
AESNLTEMSRKIYPLNLLTWKSLVAVARAHFVAYCVTSAISQEVSVIKANTLTDTTEKLF
KKNSKYRKRYMWECFKLYYLKQQKNGK
Cross Reference
© Center for Bioinformatics, Peking University