NATsDB: Natural Antisense Transcripts DataBase
Browse Search Help Download
BC043205 SA cluster:33325  ?
General information
UniGene ClusterHs.265165
DescriptionHomo sapiens chromosome 8 open reading frame 50, mRNA (cDNA clone IMAGE:5295006)
Local annotation
Conceptual translation>XP_499109:PREDICTED: hypothetical protein XP_499109 [Homo sapiens](Evalue:2.9e-32 Identity:0.547 Coverage:0.209/1.449)
NTQNTGLLLQGFLAREPQTHRTWRSRVELAPGPALGWSAALRRTAPQRQARSCRPYPLAL
SAGAQAQCSSKEAEKMLKTDAHGGQLGLRIT/SCKTNL*KPIATCFLEHTLHLSTPKLVP
TRILLFLSSFSCSPVSYSLFLSFPLDYYKQMLSKSYRHHMCTCATLTVTNLLKSRQEEAK
FKNQKHCRK*KWSECCLGIINFFFFNSSSTWLSSKGTRPQQAGAWQCGRRHHRRQGRTTR
PWFISTLAREDVQ\EVSAAR
>NP_060312:hypothetical protein LOC55652 [Homo sapiens](Evalue:2.3e-16 Identity:0.636 Coverage:0.087/0.448)
SCM*FFFFFLFFWRQSLALSPRLECSGVILAHCNLRLLGSSSS--RAS\RAAGNTSIHHH
A-QL/YLFLVEMGFHHVAQADLELLRSGNLPTSASQSAGITGISHHTQP
>NP_001009002:ubiquitously transcribed tetratricopeptide repeat gene, Y-linked [Pan troglodytes](Evalue:5.3e-15 Identity:0.647 Coverage:0.069/0.079)
QAGVQWRDFGSLQPPPSGFKQFS--CLP\DSWEYKHTPPCPANL-FLVEMGFHHVAQADL
ELLRSGNLPTSASQSAGITGISHHTQ
Cross Reference
GeneC8orf50 chromosome 8 open reading frame 50
© Center for Bioinformatics, Peking University