NATsDB: Natural Antisense Transcripts DataBase
Browse Search Help Download
L04961 SA cluster:29777  ?
General information
UniGene ClusterMm.274770
DescriptionMouse nuclear-localized inactive X-specific transcript (Xist) mRNA
Local annotation
Conceptual translation>NP_912602:GABA-A receptor epsilon-like subunit [Oryza sativa (japonica cultivar-group)](Evalue:2.9e-16 Identity:0.547 Coverage:0.022/0.388)
PQPQAQPQPLPQPQPQPLPQPQPLPLPQPQPQPLPLPLPLP/LPN---QPNP-VQ/PLPQ
PSPSPRPRYFQTYPKPTST*RNSNLH*FSAKMQCPSLSL*D*DSPSTP
>NP_970455:hypothetical protein Bd3745 [Bdellovibrio bacteriovorus HD100](Evalue:2.2e-15 Identity:0.548 Coverage:0.017/0.186)
SPQDSANSAAAIAAPAPGPAPAPAPAPAPAPAPAPAPAPAPAPAPAPTPAPAPAPPNQPN
PV-QPCPSPVLAPGPDTFRPIPSP
>YP_113681:metalloprotease, putative [Methylococcus capsulatus str. Bath](Evalue:3.5e-15 Identity:0.51 Coverage:0.02/0.114)
CCPSPRPSPSPCPSPSPSPCPSPSPCPCPSPSPSPYPCPCPCPTQPTQSSPALPQPSPSP
RPRYFQTYPKPTST*R---NSNLH*FSAKMQCPSLS
Possible ORF>ORF_1 Region:[112-429]
ENISKFHEIFDVLICSGKIFFLTCPPYFLIFVIFSVNFSFLRNISLLCLLVDTCVCMVDL
PFFHCLYNLAHRGHGYLCVLPAIPCPTGFWILTCLFILFFSYYFFF
>ORF_2 Region:[2730-3128]
GLHFNFLCVLAFMALDSPQDSANSAAAIAAPAPGPAPAPAPAPAPAPAPAPAPAPAPAPA
PAPTPAPAPAPPNQPNPVQPCPSPVLAPGPDTFRPIPSPLLLREIRIFIDSVLKCSVHHS
AYKTETAHLPPPY
>ORF_3 Region:[3218-3553]
PIYTPSILTYRVMEFHLMHAVLLLKCSAHNSAYKTEIAHLYPHTPSILTSRVMEFHLIHR
IVLLKCSVHHSVYKTEISLCIPHTPSILTSRVIEFHFAYGPIAKMQCPSLSL
>ORF_4 Region:[4496-4858]
PIYTPSILSSRVMEFHLMHRIVLLKCSAHHSAYKTEPIYTPYPSILTSRVMEFHFAYSPT
LLVHGQVNKELLSFMLIKIHQSNKSFISETCHGRVSSLKSPFPLRKENHSVIAVVVTVPS
F
>ORF_5 Region:[4603-4902]
AHLYPIPLHTDFQSHGISLCIQSYFTCPWTSKQRTLVLHVNQDTPIKQEFYIRDLPWEGI
ISQVSFSFKERKPFCHCCSSHSPKFLSSVQSSFLMYYLEY
>ORF_6 Region:[6866-7228]
STRPHSFGLLSYIKCMRMHCHLLCALERIPLTSLAPSAGSDNKLKTFIWKVHMSKHFSKN
YCTLFSALKQKEGCTKCSSFGLKCINAVSCPSLPLELDFTSLYSFDTRGILIISEHFSCQ
Y
>ORF_7 Region:[9551-9862]
RVLERAQRDKQSLCETQGLPAAYTATLHLSRTSLQVLATLNKKLTGHMEKKRSPPRIVGL
LLCSAGDLFPLTIPRWRWGMRILQGNSSPPLGNRPSPDFSETLS
>ORF_8 Region:[9792-10121]
GSSRGIAHHHWATGLAQISVRRFPEPSKEDKGSKNATLHQSRRKAAAIVALTFEEAILLY
LVLSPEARKALPAVYILQDALLPYSCHIIHNAIYQILPFPKAAQKTGSSA
>ORF_9 Region:[10190-10729]
LQHLKSNRMSVYCGCVYFLFYVSIFSLVCVSNSLLHLFLPCFVCLFLPCFVCLFLPCIMS
NSLLYLFLPCFVSISSLQLCLILCYIYFFLALCVYFFLALCLILCYIYFFLALCVCLPCF
VSISSLQLCLILCYIYFFLAFVCLSFLLLCVYFFLAVVSNSLLHLFLPCFCVSISSLHCV
>ORF_10 Region:[10669-11049]
FFVTSISSLLLCVYFFLALCLILWYIYFFIALCVYVSLCCLIRCCIYFFLALCVYFFLAL
CVYVFLALCVYVFLVLCIYFFLVCLILCYIYFFLPLHVSFFPLCVFSVCSVSYLFPCFSC
MFFLAEL
>ORF_11 Region:[10581-11591]
FFVTSISSLLLCVFLSCFCVSISSLQLCLILCYIYFFLAFVCLFLPCIVSNSLVYIFLHC
FVCLCLLVLSNSLLHLFLPCFVCLFLPCFVCLCLPCFVCLCLPCFVYLLLPCVSNSLLHL
FLPSFACLLLSFVCLFCLQCVLPIPMFLLHVLSCRALSFVSLSLVPVWSALSSLAMALCF
IYLVAISLSFSFTPAFRDSLWVTCCMHPSLFLVLTPLVLCSSSLCQSISVFFLLLLSLVN
SCLHFFPAFLGPLSLFSFDFVSLCYWWISYLSIILLLCVCLCFYLLLSSFLFTLSISSLY
KSVSLLYSKVILSWMFLCMYMCVCACVLCVSCVRGAS
Cross Reference
GeneXist inactive X specific transcripts
© Center for Bioinformatics, Peking University